PCCB antibody (70R-5324)

Rabbit polyclonal PCCB antibody raised against the middle region of PCCB

Synonyms Polyclonal PCCB antibody, Anti-PCCB antibody, Propionyl Coenzyme A Carboxylase Beta Polypeptide antibody, DKFZp451E113 antibody
Specificity PCCB antibody was raised against the middle region of PCCB
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PCCB antibody was raised using the middle region of PCCB corresponding to a region with amino acids PGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSS
Assay Information PCCB Blocking Peptide, catalog no. 33R-7102, is also available for use as a blocking control in assays to test for specificity of this PCCB antibody


Western Blot analysis using PCCB antibody (70R-5324)

PCCB antibody (70R-5324) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCCB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PCCB is a subunit of the propionyl-CoA carboxylase (PCC) enzyme, which is involved in the catabolism of propionyl-CoA. PCC is a mitochondrial enzyme that probably acts as a dodecamer of six alpha subunits and six beta subunits. Defects in this gene are a cause of propionic acidemia type II (PA-2).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PCCB antibody (70R-5324) | PCCB antibody (70R-5324) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors