PCDH1 antibody (70R-6115)

Rabbit polyclonal PCDH1 antibody raised against the N terminal of PCDH1

Synonyms Polyclonal PCDH1 antibody, Anti-PCDH1 antibody, MGC45991 antibody, PCDH 1, PCDH-1, PCDH42 antibody, PCDH1, PCDH-1 antibody, PCDH 1 antibody, Protocadherin 1 antibody, PC42 antibody
Specificity PCDH1 antibody was raised against the N terminal of PCDH1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PCDH1 antibody was raised using the N terminal of PCDH1 corresponding to a region with amino acids LLPSMLLALLLLLAPSPGHATRVVYKVPEEQPPNTLIGSLAADYGFPDVG
Assay Information PCDH1 Blocking Peptide, catalog no. 33R-5177, is also available for use as a blocking control in assays to test for specificity of this PCDH1 antibody

Images

Western Blot analysis using PCDH1 antibody (70R-6115)

PCDH1 antibody (70R-6115) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 111 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCDH1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PCDH1 belongs to the protocadherin subfamily within the cadherin superfamily. It is a membrane protein found at cell-cell boundaries. It is involved in neural cell adhesion, suggesting a possible role in neuronal development. The protein includes an extracelllular region, containing 7 cadherin-like domains, a transmembrane region and a C-terminal cytoplasmic region. Cells expressing the protein showed cell aggregation activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PCDH1 antibody (70R-6115) | PCDH1 antibody (70R-6115) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors