PCDH12 antibody (70R-6110)

Rabbit polyclonal PCDH12 antibody raised against the middle region of PCDH12

Synonyms Polyclonal PCDH12 antibody, Anti-PCDH12 antibody, PCDH12, VE-cadherin-2 antibody, PCDH 12 antibody, PCDH-12, Protocadherin 12 antibody, PCDH 12, PCDH-12 antibody, VECAD2 antibody
Specificity PCDH12 antibody was raised against the middle region of PCDH12
Cross Reactivity Human
Applications WB
Immunogen PCDH12 antibody was raised using the middle region of PCDH12 corresponding to a region with amino acids SSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHTGQLFVNVT
Assay Information PCDH12 Blocking Peptide, catalog no. 33R-8846, is also available for use as a blocking control in assays to test for specificity of this PCDH12 antibody

Images

Western Blot analysis using PCDH12 antibody (70R-6110)

PCDH12 antibody (70R-6110) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 126 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCDH12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PCDH12 belongs to the protocadherin protein family, a subfamily of the cadherin superfamily. It consists of an extracellular domain containing 6 cadherin repeats, a transmembrane domain and a cytoplasmic tail that differs from those of the classical cadherins. The function of this cellular adhesion protein is undetermined but mouse protocadherin 12 does not bind catenins and appears to have no affect on cell migration or growth.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PCDH12 antibody (70R-6110) | PCDH12 antibody (70R-6110) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors