PCDH15 antibody (70R-6995)

Rabbit polyclonal PCDH15 antibody raised against the N terminal of PCDH15

Synonyms Polyclonal PCDH15 antibody, Anti-PCDH15 antibody, PCDH 15 antibody, DFNB23 antibody, PCDH-15, PCDH-15 antibody, RP11-449J3.2 antibody, PCDH 15, USH1F antibody, Protocadherin 15 antibody, DKFZp667A1711 antibody, PCDH15
Specificity PCDH15 antibody was raised against the N terminal of PCDH15
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PCDH15 antibody was raised using the N terminal of PCDH15 corresponding to a region with amino acids HSIVVQVQCINKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTP
Assay Information PCDH15 Blocking Peptide, catalog no. 33R-3853, is also available for use as a blocking control in assays to test for specificity of this PCDH15 antibody

Images

Western Blot analysis using PCDH15 antibody (70R-6995)

PCDH15 antibody (70R-6995) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 80 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCDH15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PCDH15 is a member of the cadherin superfamily. Family members encode integral membrane proteins that mediate calcium-dependent cell-cell adhesion. PCDH15 consists of a signal peptide, 11 extracellular calcium-binding domains, a transmembrane domain and a unique cytoplasmic domain. It plays an essential role in maintenance of normal retinal and cochlear function. Mutations in this gene have been associated with hearing loss, which is consistent with its location at the Usher syndrome type 1F (USH1F) critical region on chromosome 10.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PCDH15 antibody (70R-6995) | PCDH15 antibody (70R-6995) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors