PCDHA10 antibody (70R-6165)

Rabbit polyclonal PCDHA10 antibody raised against the N terminal of PCDHA10

Synonyms Polyclonal PCDHA10 antibody, Anti-PCDHA10 antibody, CNRN8 antibody, PCDHA10, CNR8 antibody, PCDH-ALPHA10 antibody, PCDHA-10, CRNR8 antibody, PCDHA-10 antibody, PCDHA 10, CNRS8 antibody, Protocadherin Alpha 10 antibody, PCDHA 10 antibody
Specificity PCDHA10 antibody was raised against the N terminal of PCDHA10
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PCDHA10 antibody was raised using the N terminal of PCDHA10 corresponding to a region with amino acids ESRLLDSRFPLEGASDADVGENALLTYKLSPNEYFVLDIINKKDKDKFPV
Assay Information PCDHA10 Blocking Peptide, catalog no. 33R-2743, is also available for use as a blocking control in assays to test for specificity of this PCDHA10 antibody

Images

Western Blot analysis using PCDHA10 antibody (70R-6165)

PCDHA10 antibody (70R-6165) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 89 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCDHA10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PCDHA10 antibody (70R-6165) | PCDHA10 antibody (70R-6165) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors