PCDHA12 antibody (70R-6159)

Rabbit polyclonal PCDHA12 antibody raised against the N terminal of PCDHA12

Synonyms Polyclonal PCDHA12 antibody, Anti-PCDHA12 antibody, PCDH-ALPHA12 antibody, PCDHA12, PCDHA 12, MGC138485 antibody, MGC141932 antibody, Protocadherin Alpha 12 antibody, PCDHA-12 antibody, PCDHA-12, PCDHA 12 antibody
Specificity PCDHA12 antibody was raised against the N terminal of PCDHA12
Cross Reactivity Human,Rat
Applications WB
Immunogen PCDHA12 antibody was raised using the N terminal of PCDHA12 corresponding to a region with amino acids EVIVDRPLQVFHVDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEG
Assay Information PCDHA12 Blocking Peptide, catalog no. 33R-2791, is also available for use as a blocking control in assays to test for specificity of this PCDHA12 antibody

Images

Western Blot analysis using PCDHA12 antibody (70R-6159)

PCDHA12 antibody (70R-6159) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 99 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCDHA12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PCDHA12 is a potential calcium-dependent cell-adhesion protein. PCDHA12 may be involved in the establishment and maintenance of specific neuronal connections in the brain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PCDHA12 antibody (70R-6159) | PCDHA12 antibody (70R-6159) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors