PCDHA3 antibody (70R-6168)

Rabbit polyclonal PCDHA3 antibody raised against the N terminal of PCDHA3

Synonyms Polyclonal PCDHA3 antibody, Anti-PCDHA3 antibody, PCDHA 3 antibody, MGC141669 antibody, PCDH-ALPHA3 antibody, PCDHA 3, PCDHA3, Protocadherin Alpha 3 antibody, PCDHA-3 antibody, PCDHA-3
Specificity PCDHA3 antibody was raised against the N terminal of PCDHA3
Cross Reactivity Human
Applications WB
Immunogen PCDHA3 antibody was raised using the N terminal of PCDHA3 corresponding to a region with amino acids LFSWREDPGAQCLLLSLLLLAASEVGSGQLHYSVSEEAKHGTFVGRIAQD
Assay Information PCDHA3 Blocking Peptide, catalog no. 33R-4950, is also available for use as a blocking control in assays to test for specificity of this PCDHA3 antibody

Images

Western Blot analysis using PCDHA3 antibody (70R-6168)

PCDHA3 antibody (70R-6168) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 99 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCDHA3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PCDHA3 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHA3 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PCDHA3 antibody (70R-6168) | PCDHA3 antibody (70R-6168) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors