PCDHA4 antibody (70R-6164)

Rabbit polyclonal PCDHA4 antibody raised against the C terminal of PCDHA4

Synonyms Polyclonal PCDHA4 antibody, Anti-PCDHA4 antibody, PCDH-ALPHA4 antibody, PCDHA 4, CRNR1 antibody, CNR1 antibody, CNRN1 antibody, PCDHA-4, PCDHA4, Protocadherin Alpha 4 antibody, PCDHA-4 antibody, PCDHA 4 antibody, MGC138307 antibody, MGC142169 antibody
Specificity PCDHA4 antibody was raised against the C terminal of PCDHA4
Cross Reactivity Human
Applications WB
Immunogen PCDHA4 antibody was raised using the C terminal of PCDHA4 corresponding to a region with amino acids SGYNAWLSYELQPETASASIPFRVGLYTGEISTTRALDETDAPRQRLLVL
Assay Information PCDHA4 Blocking Peptide, catalog no. 33R-8505, is also available for use as a blocking control in assays to test for specificity of this PCDHA4 antibody

Images

Western Blot analysis using PCDHA4 antibody (70R-6164)

PCDHA4 antibody (70R-6164) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 99 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCDHA4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The gene encoding PCDHA4 is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. PCDHA4 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHA4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PCDHA4 antibody (70R-6164) | PCDHA4 antibody (70R-6164) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors