PCDHA5 antibody (70R-6167)

Rabbit polyclonal PCDHA5 antibody raised against the N terminal of PCDHA5

Synonyms Polyclonal PCDHA5 antibody, Anti-PCDHA5 antibody, PCDHA5, PCDHA-5 antibody, CNR6 antibody, CRNR6 antibody, CNRN6 antibody, PCDHA 5, PCDHA 5 antibody, Protocadherin Alpha 5 antibody, CNRS6 antibody, PCDH-ALPHA5 antibody, PCDHA-5
Specificity PCDHA5 antibody was raised against the N terminal of PCDHA5
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PCDHA5 antibody was raised using the N terminal of PCDHA5 corresponding to a region with amino acids VYSRRGSLGSRLLLLWLLLAYWKAGSGQLHYSIPEEAKHGTFVGRIAQDL
Assay Information PCDHA5 Blocking Peptide, catalog no. 33R-9928, is also available for use as a blocking control in assays to test for specificity of this PCDHA5 antibody

Images

Western Blot analysis using PCDHA5 antibody (70R-6167)

PCDHA5 antibody (70R-6167) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 99 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCDHA5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The gene encoding PCDHA5 is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. PCDHA5 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHA5 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PCDHA5 antibody (70R-6167) | PCDHA5 antibody (70R-6167) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors