PCDHA6 antibody (70R-6169)

Rabbit polyclonal PCDHA6 antibody raised against the C terminal of PCDHA6

Synonyms Polyclonal PCDHA6 antibody, Anti-PCDHA6 antibody, CNR2 antibody, PCDHA 6, PCDHA-6 antibody, PCDHA6, PCDHA-6, CNRN2 antibody, PCDH-ALPHA6 antibody, CNRS2 antibody, Protocadherin Alpha 6 antibody, PCDHA 6 antibody, CRNR2 antibody
Specificity PCDHA6 antibody was raised against the C terminal of PCDHA6
Cross Reactivity Human,Rat
Applications WB
Immunogen PCDHA6 antibody was raised using the C terminal of PCDHA6 corresponding to a region with amino acids LVKDHGEPALTATATVLVSLVESGQAPKASSRASVGAAGPEAALVDVNVY
Assay Information PCDHA6 Blocking Peptide, catalog no. 33R-5518, is also available for use as a blocking control in assays to test for specificity of this PCDHA6 antibody

Images

Western Blot analysis using PCDHA6 antibody (70R-6169)

PCDHA6 antibody (70R-6169) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 84 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCDHA6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PCDHA6 contains 6 cadherin domains. It is a potential calcium-dependent cell-adhesion protein. PCDHA6 may be involved in the establishment and maintenance of specific neuronal connections in the brain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PCDHA6 antibody (70R-6169) | PCDHA6 antibody (70R-6169) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors