PCDHAC1 antibody (70R-6120)

Rabbit polyclonal PCDHAC1 antibody raised against the N terminal of PCDHAC1

Synonyms Polyclonal PCDHAC1 antibody, Anti-PCDHAC1 antibody, PCDHAC1, Protocadherin Alpha Subfamily C 1 antibody, PCDH-ALPHA-C1 antibody, PCDHAC-1, PCDHAC 1, PCDHAC-1 antibody, PCDHAC 1 antibody
Specificity PCDHAC1 antibody was raised against the N terminal of PCDHAC1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PCDHAC1 antibody was raised using the N terminal of PCDHAC1 corresponding to a region with amino acids RVQALDPDEGSNGEVQYSLSNSTQAELRHRFHVHPKSGEVQVAASLGPPE
Assay Information PCDHAC1 Blocking Peptide, catalog no. 33R-8254, is also available for use as a blocking control in assays to test for specificity of this PCDHAC1 antibody

Images

Western Blot analysis using PCDHAC1 antibody (70R-6120)

PCDHAC1 antibody (70R-6120) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 87 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCDHAC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PCDHAC1 is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PCDHAC1 antibody (70R-6120) | PCDHAC1 antibody (70R-6120) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors