PCDHAC2 antibody (70R-6121)

Rabbit polyclonal PCDHAC2 antibody raised against the N terminal of PCDHAC2

Synonyms Polyclonal PCDHAC2 antibody, Anti-PCDHAC2 antibody, MGC71598 antibody, PCDHAC 2 antibody, PCDHAC-2 antibody, PCDHAC 2, PCDHAC2, Protocadherin Alpha Subfamily C 2 antibody, PCDH-ALPHA-C2 antibody, PCDHAC-2
Specificity PCDHAC2 antibody was raised against the N terminal of PCDHAC2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PCDHAC2 antibody was raised using the N terminal of PCDHAC2 corresponding to a region with amino acids SPAFDQSTYRVQLREDSPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDR
Assay Information PCDHAC2 Blocking Peptide, catalog no. 33R-8663, is also available for use as a blocking control in assays to test for specificity of this PCDHAC2 antibody

Images

Western Blot analysis using PCDHAC2 antibody (70R-6121)

PCDHAC2 antibody (70R-6121) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 105 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCDHAC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PCDHAC2 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PCDHAC2 antibody (70R-6121) | PCDHAC2 antibody (70R-6121) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors