PCDHB13 antibody (70R-6119)

Rabbit polyclonal PCDHB13 antibody raised against the middle region of PCDHB13

Synonyms Polyclonal PCDHB13 antibody, Anti-PCDHB13 antibody, PCDH-BETA13 antibody, PCDHB13, PCDHB 13, PCDHB-13, PCDHB-13 antibody, Protocadherin Beta 13 antibody, PCDHB 13 antibody
Specificity PCDHB13 antibody was raised against the middle region of PCDHB13
Cross Reactivity Human
Applications WB
Immunogen PCDHB13 antibody was raised using the middle region of PCDHB13 corresponding to a region with amino acids GKTFKINPLTGEIELKKQLDFEKLQSYEVNIEARDAGTFSGKCTVLIQVI
Assay Information PCDHB13 Blocking Peptide, catalog no. 33R-3378, is also available for use as a blocking control in assays to test for specificity of this PCDHB13 antibody

Images

Western Blot analysis using PCDHB13 antibody (70R-6119)

PCDHB13 antibody (70R-6119) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 85 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCDHB13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PCDHB13 is a member of the protocadherin beta gene cluster, one of three related gene clusters tandemly linked on chromosome five. The gene clusters demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The beta cluster contains 16 genes and 3 pseudogenes, each encoding 6 extracellular cadherin domains and a cytoplasmic tail that deviates from others in the cadherin superfamily.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PCDHB13 antibody (70R-6119) | PCDHB13 antibody (70R-6119) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors