PCDHGA4 antibody (70R-6139)

Rabbit polyclonal PCDHGA4 antibody raised against the N terminal of PCDHGA4

Synonyms Polyclonal PCDHGA4 antibody, Anti-PCDHGA4 antibody, PCDH-GAMMA-A4 antibody, PCDHGA 4, PCDHGA-4, PCDHGA 4 antibody, Protocadherin Gamma Subfamily A 4 antibody, PCDHGA-4 antibody, PCDHGA4
Specificity PCDHGA4 antibody was raised against the N terminal of PCDHGA4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PCDHGA4 antibody was raised using the N terminal of PCDHGA4 corresponding to a region with amino acids GDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRENVPVGTRLLTVKAT
Assay Information PCDHGA4 Blocking Peptide, catalog no. 33R-3205, is also available for use as a blocking control in assays to test for specificity of this PCDHGA4 antibody

Images

Western Blot analysis using PCDHGA4 antibody (70R-6139)

PCDHGA4 antibody (70R-6139) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 86 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCDHGA4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PCDHGA4 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHGA4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PCDHGA4 antibody (70R-6139) | PCDHGA4 antibody (70R-6139) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors