PCDHGB1 antibody (70R-6147)

Rabbit polyclonal PCDHGB1 antibody raised against the N terminal of PCDHGB1

Synonyms Polyclonal PCDHGB1 antibody, Anti-PCDHGB1 antibody, PCDHGB 1 antibody, Protocadherin Gamma Subfamily B 1 antibody, PCDHGB1, PCDH-GAMMA-B1 antibody, PCDHGB 1, MGC119466 antibody, MGC119469 antibody, MGC119467 antibody, PCDHGB-1 antibody, PCDHGB-1
Specificity PCDHGB1 antibody was raised against the N terminal of PCDHGB1
Cross Reactivity Human
Applications WB
Immunogen PCDHGB1 antibody was raised using the N terminal of PCDHGB1 corresponding to a region with amino acids SPDGSKYPVLLLEKPLDREHQSSHRLILTAMDGGDPPLSGTTHIWIRVTD
Assay Information PCDHGB1 Blocking Peptide, catalog no. 33R-8667, is also available for use as a blocking control in assays to test for specificity of this PCDHGB1 antibody


Western Blot analysis using PCDHGB1 antibody (70R-6147)

PCDHGB1 antibody (70R-6147) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 85 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCDHGB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PCDHGB1 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHGB1 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PCDHGB1 antibody (70R-6147) | PCDHGB1 antibody (70R-6147) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors