PCDHGC3 antibody (70R-6138)

Rabbit polyclonal PCDHGC3 antibody raised against the N terminal of PCDHGC3

Synonyms Polyclonal PCDHGC3 antibody, Anti-PCDHGC3 antibody, PCDHGC 3, PCDHGC 3 antibody, PCDH2 antibody, PCDH-GAMMA-C3 antibody, PCDHGC-3, PCDHGC3, Protocadherin Gamma Subfamily C 3 antibody, PC43 antibody, PCDHGC-3 antibody
Specificity PCDHGC3 antibody was raised against the N terminal of PCDHGC3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PCDHGC3 antibody was raised using the N terminal of PCDHGC3 corresponding to a region with amino acids ISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNEYFALRVQTREDSTKY
Assay Information PCDHGC3 Blocking Peptide, catalog no. 33R-4148, is also available for use as a blocking control in assays to test for specificity of this PCDHGC3 antibody

Images

Western Blot analysis using PCDHGC3 antibody (70R-6138)

PCDHGC3 antibody (70R-6138) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 91 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCDHGC3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. PCDHGC3 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PCDHGC3 antibody (70R-6138) | PCDHGC3 antibody (70R-6138) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors