PCGF1 antibody (70R-4454)

Rabbit polyclonal PCGF1 antibody raised against the middle region of PCGF1

Synonyms Polyclonal PCGF1 antibody, Anti-PCGF1 antibody, PCGF-1 antibody, NSPC1 antibody, 2010002K04Rik antibody, PCGF-1, MGC10882 antibody, RNF68 antibody, FLJ43754 antibody, PCGF1, PCGF 1, PCGF 1 antibody, Polycomb Group Ring Finger 1 antibody, RNF3A-2 antibody
Specificity PCGF1 antibody was raised against the middle region of PCGF1
Cross Reactivity Human
Applications WB
Immunogen PCGF1 antibody was raised using the middle region of PCGF1 corresponding to a region with amino acids PALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYV
Assay Information PCGF1 Blocking Peptide, catalog no. 33R-6967, is also available for use as a blocking control in assays to test for specificity of this PCGF1 antibody


Western Blot analysis using PCGF1 antibody (70R-4454)

PCGF1 antibody (70R-4454) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCGF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors to regulate anterior-posterior patterning in early embryonic development.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PCGF1 antibody (70R-4454) | PCGF1 antibody (70R-4454) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors