PCSK1 antibody (70R-5420)

Rabbit polyclonal PCSK1 antibody raised against the middle region of PCSK1

Synonyms Polyclonal PCSK1 antibody, Anti-PCSK1 antibody, PCSK-1, NEC1 antibody, PCSK 1 antibody, PCSK-1 antibody, SPC3 antibody, PCSK1, Proprotein Convertase Subtilisin/Kexin Type 1 antibody, PCSK 1, PC1 antibody, PC3 antibody
Specificity PCSK1 antibody was raised against the middle region of PCSK1
Cross Reactivity Human
Applications WB
Immunogen PCSK1 antibody was raised using the middle region of PCSK1 corresponding to a region with amino acids QSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTK
Assay Information PCSK1 Blocking Peptide, catalog no. 33R-7733, is also available for use as a blocking control in assays to test for specificity of this PCSK1 antibody

Images

Western Blot analysis using PCSK1 antibody (70R-5420)

PCSK1 antibody (70R-5420) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCSK1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PCSK1 is involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Substrates include POMC, renin, enkephalin, dynorphin, somatostatin and insulin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PCSK1 antibody (70R-5420) | PCSK1 antibody (70R-5420) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors