PDCD7 antibody (70R-6012)

Rabbit polyclonal PDCD7 antibody raised against the middle region of PDCD7

Synonyms Polyclonal PDCD7 antibody, Anti-PDCD7 antibody, MGC22015 antibody, PDCD 7, HES18 antibody, PDCD-7 antibody, PDCD7, PDCD 7 antibody, PDCD-7, ES18 antibody, Programmed Cell Death 7 antibody
Specificity PDCD7 antibody was raised against the middle region of PDCD7
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PDCD7 antibody was raised using the middle region of PDCD7 corresponding to a region with amino acids YLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWAT
Assay Information PDCD7 Blocking Peptide, catalog no. 33R-10177, is also available for use as a blocking control in assays to test for specificity of this PDCD7 antibody

Images

Western Blot analysis using PDCD7 antibody (70R-6012)

PDCD7 antibody (70R-6012) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDCD7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PDCD7 is a protein with sequence similarity to a mouse protein originally identified in embryonic stem cells. In mouse T-cell lines, this protein appears to be related to glucocorticoid- and staurine-induced apoptotic pathways, and to be linked to ceramide-mediated signalling. These observations suggest that this gene product is involved in specific apoptotic processes in T-cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PDCD7 antibody (70R-6012) | PDCD7 antibody (70R-6012) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors