PDE3A antibody (70R-6279)

Rabbit polyclonal PDE3A antibody raised against the N terminal of PDE3A

Synonyms Polyclonal PDE3A antibody, Anti-PDE3A antibody, PDEA-3, Phosphodiesterase 3A Cgmp-Inhibited antibody, CGI-PDE antibody, PDEA 3 antibody, PDE3A, PDEA-3 antibody, PDEA 3
Specificity PDE3A antibody was raised against the N terminal of PDE3A
Cross Reactivity Human
Applications WB
Immunogen PDE3A antibody was raised using the N terminal of PDE3A corresponding to a region with amino acids LLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSD
Assay Information PDE3A Blocking Peptide, catalog no. 33R-5115, is also available for use as a blocking control in assays to test for specificity of this PDE3A antibody

Images

Western Blot analysis using PDE3A antibody (70R-6279)

PDE3A antibody (70R-6279) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 125 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDE3A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PDE3A belongs to the cyclic nucleotide phosphodiesterase family. It hydrolyzes both cyclic AMP (cAMP) and cyclic GMP (cGMP).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PDE3A antibody (70R-6279) | PDE3A antibody (70R-6279) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors