PDE3B antibody (70R-6283)

Rabbit polyclonal PDE3B antibody raised against the middle region of PDE3B

Synonyms Polyclonal PDE3B antibody, Anti-PDE3B antibody, Phosphodiesterase 3B Cgmp-Inhibited antibody, HcGIP1 antibody, PDEB 3, PDEB-3, PDEB-3 antibody, PDEB 3 antibody, PDE3B, cGIPDE1 antibody
Specificity PDE3B antibody was raised against the middle region of PDE3B
Cross Reactivity Human
Applications WB
Immunogen PDE3B antibody was raised using the middle region of PDE3B corresponding to a region with amino acids SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVN
Assay Information PDE3B Blocking Peptide, catalog no. 33R-8765, is also available for use as a blocking control in assays to test for specificity of this PDE3B antibody

Images

Western Blot analysis using PDE3B antibody (70R-6283)

PDE3B antibody (70R-6283) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 124 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDE3B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PDE3B belongs to the cyclic nucleotide phosphodiesterase family. It may play a role in fat metabolism.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PDE3B antibody (70R-6283) | PDE3B antibody (70R-6283) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors