PDE7B antibody (70R-2093)

Rabbit polyclonal PDE7B antibody raised against the middle region of PDE7B

Synonyms Polyclonal PDE7B antibody, Anti-PDE7B antibody, MGC88256 antibody, bA472E5.1 antibody, PDEB 7 antibody, PDEB 7, PDEB-7 antibody, PDEB-7, Phosphodiesterase 7B antibody, PDE7B
Specificity PDE7B antibody was raised against the middle region of PDE7B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PDE7B antibody was raised using the middle region of PDE7B corresponding to a region with amino acids IGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN
Assay Information PDE7B Blocking Peptide, catalog no. 33R-3973, is also available for use as a blocking control in assays to test for specificity of this PDE7B antibody

Images

Western Blot analysis using PDE7B antibody (70R-2093)

PDE7B antibody (70R-2093) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDE7B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The 3',5'-cyclic nucleotides cAMP and cGMP function as second messengers in a wide variety of signal transduction pathways.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PDE7B antibody (70R-2093) | PDE7B antibody (70R-2093) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors