PDE7B antibody (70R-2093)
Rabbit polyclonal PDE7B antibody raised against the middle region of PDE7B
Overview
Overview
Synonyms | Polyclonal PDE7B antibody, Anti-PDE7B antibody, MGC88256 antibody, bA472E5.1 antibody, PDEB 7 antibody, PDEB 7, PDEB-7 antibody, PDEB-7, Phosphodiesterase 7B antibody, PDE7B |
---|---|
Specificity | PDE7B antibody was raised against the middle region of PDE7B |
Cross Reactivity | Human,Mouse,Rat |
Applications | WB |
Immunogen | PDE7B antibody was raised using the middle region of PDE7B corresponding to a region with amino acids IGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN |
Assay Information | PDE7B Blocking Peptide, catalog no. 33R-3973, is also available for use as a blocking control in assays to test for specificity of this PDE7B antibody |
Images
Western Blot analysis using PDE7B antibody (70R-2093)
PDE7B antibody (70R-2093) used at 1 ug/ml to detect target protein.
Specifications
Host | Rabbit |
---|---|
Method of Purification | Affinity purified |
Molecular Weight | 52 kDa (MW of target protein) |
Form & Buffer | Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDE7B antibody in PBS |
Concentration | 1 mg/ml |
Usage & Assay Information
Usage Recommendations | WB: 1 ug/ml |
---|
Storage & Safety
Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
---|
General Information
Biological Significance | The 3',5'-cyclic nucleotides cAMP and cGMP function as second messengers in a wide variety of signal transduction pathways. |
---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product