PDE9A antibody (70R-2061)

Rabbit polyclonal PDE9A antibody raised against the N terminal of PDE9A

Synonyms Polyclonal PDE9A antibody, Anti-PDE9A antibody, PDEA 9, PDE9A, PDEA-9, PDEA-9 antibody, Phosphodiesterase 9A antibody, HSPDE9A2 antibody, PDEA 9 antibody
Specificity PDE9A antibody was raised against the N terminal of PDE9A
Cross Reactivity Human
Applications IHC, WB
Immunogen PDE9A antibody was raised using the N terminal of PDE9A corresponding to a region with amino acids SDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPET
Assay Information PDE9A Blocking Peptide, catalog no. 33R-8356, is also available for use as a blocking control in assays to test for specificity of this PDE9A antibody

Images

Western Blot analysis using PDE9A antibody (70R-2061)

PDE9A antibody (70R-2061) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDE9A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PDE9A catalyzes the hydrolysis of cAMP and cGMP to their corresponding monophosphates. The protein plays a role in signal transduction by regulating the intracellular concentration of these cyclic nucleotides.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PDE9A antibody (70R-2061) | PDE9A antibody (70R-2061) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using PDE9A antibody (70R-2061) | PDE9A antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors