PDGFB antibody (70R-5691)

Rabbit polyclonal PDGFB antibody raised against the N terminal of PDGFB

Synonyms Polyclonal PDGFB antibody, Anti-PDGFB antibody, FLJ12858 antibody, c-sis antibody, PDGF2 antibody, SSV antibody, Platelet-Derived Growth Factor Beta Polypeptide antibody, SIS antibody
Specificity PDGFB antibody was raised against the N terminal of PDGFB
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD
Assay Information PDGFB Blocking Peptide, catalog no. 33R-6853, is also available for use as a blocking control in assays to test for specificity of this PDGFB antibody


Western Blot analysis using PDGFB antibody (70R-5691)

PDGFB antibody (70R-5691) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDGFB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PDGFB is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. PDGFB can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 7, at sites where this gene and that for COL1A1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PDGFB antibody (70R-5691) | PDGFB antibody (70R-5691) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors