PDGFD antibody (70R-6220)

Rabbit polyclonal PDGFD antibody raised against the N terminal of PDGFD

Synonyms Polyclonal PDGFD antibody, Anti-PDGFD antibody, Platelet Derived Growth Factor D antibody, MSTP036 antibody, SCDGF-B antibody, IEGF antibody, MGC26867 antibody
Specificity PDGFD antibody was raised against the N terminal of PDGFD
Cross Reactivity Human,Rat
Applications WB
Immunogen PDGFD antibody was raised using the N terminal of PDGFD corresponding to a region with amino acids NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH
Assay Information PDGFD Blocking Peptide, catalog no. 33R-6641, is also available for use as a blocking control in assays to test for specificity of this PDGFD antibody

Images

Western Blot analysis using PDGFD antibody (70R-6220)

PDGFD antibody (70R-6220) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDGFD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PDGFD antibody (70R-6220) | PDGFD antibody (70R-6220) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors