PDIA4 antibody (70R-7387)

Rabbit polyclonal PDIA4 antibody raised against the middle region of PDIA4

Synonyms Polyclonal PDIA4 antibody, Anti-PDIA4 antibody, PDIA4, Protein Disulfide Isomerase Family A Member 4 antibody, PDIA-4 antibody, ERP72 antibody, ERP70 antibody, PDIA 4, PDIA 4 antibody, PDIA-4
Specificity PDIA4 antibody was raised against the middle region of PDIA4
Cross Reactivity Human,Mouse
Applications WB
Immunogen PDIA4 antibody was raised using the middle region of PDIA4 corresponding to a region with amino acids TAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIEFYA
Assay Information PDIA4 Blocking Peptide, catalog no. 33R-8972, is also available for use as a blocking control in assays to test for specificity of this PDIA4 antibody

Images

Western Blot analysis using PDIA4 antibody (70R-7387)

PDIA4 antibody (70R-7387) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 73 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDIA4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of PDIA4 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PDIA4 antibody (70R-7387) | PDIA4 antibody (70R-7387) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors