PDXDC1 antibody (70R-4233)

Rabbit polyclonal PDXDC1 antibody raised against the N terminal of PDXDC1

Synonyms Polyclonal PDXDC1 antibody, Anti-PDXDC1 antibody, PDXDC 1, LP8165 antibody, PDXDC 1 antibody, PDXDC-1, PDXDC1, Pyridoxal-Dependent Decarboxylase Domain Containing 1 antibody, KIAA0251 antibody, PDXDC-1 antibody
Specificity PDXDC1 antibody was raised against the N terminal of PDXDC1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PDXDC1 antibody was raised using the N terminal of PDXDC1 corresponding to a region with amino acids DEDEEPQSPRIQNIGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDT
Assay Information PDXDC1 Blocking Peptide, catalog no. 33R-1893, is also available for use as a blocking control in assays to test for specificity of this PDXDC1 antibody


Western Blot analysis using PDXDC1 antibody (70R-4233)

PDXDC1 antibody (70R-4233) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 87 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDXDC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PDXDC1 belongs to the group II decarboxylase family. The function of PDXDC1 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PDXDC1 antibody (70R-4233) | PDXDC1 antibody (70R-4233) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors