PDXK antibody (70R-3565)

Rabbit polyclonal PDXK antibody

Synonyms Polyclonal PDXK antibody, Anti-PDXK antibody, MGC15873 antibody, C21orf97 antibody, FLJ31940 antibody, DKFZp566A071 antibody, PRED79 antibody, FLJ37311 antibody, Pyridoxine Vitamin B6 Kinase antibody, MGC31754 antibody, Pyridoxal Kinase antibody, C21orf124 antibody, PKH antibody, PNK antibody, MGC52346 antibody
Cross Reactivity Human
Applications WB
Immunogen PDXK antibody was raised using a synthetic peptide corresponding to a region with amino acids PLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNK
Assay Information PDXK Blocking Peptide, catalog no. 33R-7204, is also available for use as a blocking control in assays to test for specificity of this PDXK antibody


Western Blot analysis using PDXK antibody (70R-3565)

PDXK antibody (70R-3565) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDXK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PDXK phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. PDXK is cytoplasmic and probably acts as a homodimer.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PDXK antibody (70R-3565) | PDXK antibody (70R-3565) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors