PDXK antibody (70R-3757)

Rabbit polyclonal PDXK antibody

Synonyms Polyclonal PDXK antibody, Anti-PDXK antibody, Pyridoxine Vitamin B6 Kinase antibody, C21orf97 antibody, FLJ37311 antibody, PRED79 antibody, MGC15873 antibody, DKFZp566A071 antibody, PNK antibody, C21orf124 antibody, PKH antibody, MGC31754 antibody, FLJ31940 antibody, MGC52346 antibody, Pyridoxal Kinase antibody
Cross Reactivity Human
Applications WB
Immunogen PDXK antibody was raised using a synthetic peptide corresponding to a region with amino acids RKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRN
Assay Information PDXK Blocking Peptide, catalog no. 33R-7997, is also available for use as a blocking control in assays to test for specificity of this PDXK antibody

Images

Western Blot analysis using PDXK antibody (70R-3757)

PDXK antibody (70R-3757) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDXK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PDXK phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. PDXK is cytoplasmic and probably acts as a homodimer.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PDXK antibody (70R-3757) | PDXK antibody (70R-3757) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors