PDXP antibody (70R-4378)

Rabbit polyclonal PDXP antibody

Synonyms Polyclonal PDXP antibody, Anti-PDXP antibody, Pyridoxine Vitamin B6 Phosphatase antibody, Pyridoxal Phosphatase antibody, dJ37E16.5 antibody, PLP antibody, CIN antibody, FLJ32703 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen PDXP antibody was raised using a synthetic peptide corresponding to a region with amino acids DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSI
Assay Information PDXP Blocking Peptide, catalog no. 33R-2122, is also available for use as a blocking control in assays to test for specificity of this PDXP antibody


Western Blot analysis using PDXP antibody (70R-4378)

PDXP antibody (70R-4378) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDXP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PDXP antibody (70R-4378) | PDXP antibody (70R-4378) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors