PEA15 antibody (70R-6028)

Rabbit polyclonal PEA15 antibody raised against the middle region of PEA15

Synonyms Polyclonal PEA15 antibody, Anti-PEA15 antibody, PEA15, PEA 15, PEA-15 antibody, PED antibody, Phosphoprotein Enriched In Astrocytes 15 antibody, MAT1H antibody, MAT1 antibody, HUMMAT1H antibody, PEA-15, PEA 15 antibody, HMAT1 antibody, PEA-15 antibody
Specificity PEA15 antibody was raised against the middle region of PEA15
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PEA15 antibody was raised using the middle region of PEA15 corresponding to a region with amino acids DLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKL
Assay Information PEA15 Blocking Peptide, catalog no. 33R-2058, is also available for use as a blocking control in assays to test for specificity of this PEA15 antibody

Images

Western Blot analysis using PEA15 antibody (70R-6028)

PEA15 antibody (70R-6028) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PEA15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PEA15 is a death effector domain (DED)-containing protein predominantly expressed in the central nervous system, particularly in astrocytes.PEA15 is a death effector domain (DED)-containing protein predominantly expressed in the central nervous system, particularly in astrocytes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PEA15 antibody (70R-6028) | PEA15 antibody (70R-6028) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors