PEBP1 antibody (70R-1036)

Rabbit polyclonal PEBP1 antibody raised against the C terminal of PEBP1

Synonyms Polyclonal PEBP1 antibody, Anti-PEBP1 antibody, PEBP 1 antibody, HCNP antibody, PBP antibody, PEBP-1, PEBP-1 antibody, PEBP1, RKIP antibody, Phosphatidylethanolamine Binding Protein 1 antibody, PEBP 1, PEBP antibody
Specificity PEBP1 antibody was raised against the C terminal of PEBP1
Cross Reactivity Human,Mouse
Applications WB
Immunogen PEBP1 antibody was raised using the C terminal of PEBP1 corresponding to a region with amino acids LSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK
Assay Information PEBP1 Blocking Peptide, catalog no. 33R-5442, is also available for use as a blocking control in assays to test for specificity of this PEBP1 antibody


Western Blot analysis using PEBP1 antibody (70R-1036)

PEBP1 antibody (70R-1036) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PEBP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PEBP1 binds ATP, opioids and phosphatidylethanolamine. It has lower affinity for phosphatidylinositol and phosphatidylcholine. It is also a serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PEBP1 antibody (70R-1036) | PEBP1 antibody (70R-1036) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors