PECI antibody (70R-2299)

Rabbit polyclonal PECI antibody raised against the middle region of PECI

Synonyms Polyclonal PECI antibody, Anti-PECI antibody, ACBD2 antibody, HCA88 antibody, dJ1013A10.3 antibody, Peroxisomal D3D2-Enoyl-Coa Isomerase antibody, DRS1 antibody
Specificity PECI antibody was raised against the middle region of PECI
Cross Reactivity Human,Rat
Applications WB
Immunogen PECI antibody was raised using the middle region of PECI corresponding to a region with amino acids AVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAK
Assay Information PECI Blocking Peptide, catalog no. 33R-1595, is also available for use as a blocking control in assays to test for specificity of this PECI antibody

Images

Western Blot analysis using PECI antibody (70R-2299)

PECI antibody (70R-2299) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PECI antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PECI is an auxiliary enzyme that catalyzes an isomerization step required for the beta-oxidation of unsaturated fatty acids.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PECI antibody (70R-2299) | PECI antibody (70R-2299) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors