PEF1 antibody (70R-4428)

Rabbit polyclonal PEF1 antibody raised against the middle region of PEF1

Synonyms Polyclonal PEF1 antibody, Anti-PEF1 antibody, PEF-1, PEF 1 antibody, PEF 1, PEFLIN antibody, PEF1A antibody, PEF1, PEF-1 antibody, Penta-Ef-Hand Domain Containing 1 antibody
Specificity PEF1 antibody was raised against the middle region of PEF1
Cross Reactivity Human
Applications WB
Immunogen PEF1 antibody was raised using the middle region of PEF1 corresponding to a region with amino acids WKFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSPQFTQLLVSRY
Assay Information PEF1 Blocking Peptide, catalog no. 33R-9960, is also available for use as a blocking control in assays to test for specificity of this PEF1 antibody


Western Blot analysis using PEF1 antibody (70R-4428)

PEF1 antibody (70R-4428) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PEF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpain small subunit, sorcin, grancalcin, and ALG2.PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpain small subunit.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PEF1 antibody (70R-4428) | PEF1 antibody (70R-4428) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors