PELI1 antibody (70R-3450)

Rabbit polyclonal PELI1 antibody

Synonyms Polyclonal PELI1 antibody, Anti-PELI1 antibody, DKFZp686C18116 antibody, Pellino Homolog 1 antibody, PELI 1 antibody, PELI 1, PELI-1 antibody, PELI-1, MGC50990 antibody, PELI1
Cross Reactivity Human
Applications WB
Immunogen PELI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAA
Assay Information PELI1 Blocking Peptide, catalog no. 33R-2740, is also available for use as a blocking control in assays to test for specificity of this PELI1 antibody

Images

Western Blot analysis using PELI1 antibody (70R-3450)

PELI1 antibody (70R-3450) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PELI1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PELI1 is an scaffold protein involved in the IL-1 signaling pathway via its interaction with the complex containing IRAK kinases and TRAF6. PELI1 is required for NF-kappa-B activation and IL-8 gene expression in response to IL-1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PELI1 antibody (70R-3450) | PELI1 antibody (70R-3450) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors