PEMT antibody (70R-6491)

Rabbit polyclonal PEMT antibody raised against the C terminal of PEMT

Synonyms Polyclonal PEMT antibody, Anti-PEMT antibody, MGC2483 antibody, PEMT2 antibody, PEAMT antibody, PEMPT antibody, PNMT antibody, Phosphatidylethanolamine N-Methyltransferase antibody
Specificity PEMT antibody was raised against the C terminal of PEMT
Cross Reactivity Human
Applications WB
Immunogen PEMT antibody was raised using the C terminal of PEMT corresponding to a region with amino acids GWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS
Assay Information PEMT Blocking Peptide, catalog no. 33R-3664, is also available for use as a blocking control in assays to test for specificity of this PEMT antibody

Images

Western Blot analysis using PEMT antibody (70R-6491)

PEMT antibody (70R-6491) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PEMT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PEMT is an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. The protein localizes to the endoplasmic reticulum and mitochondria-associated membranes. The gene encodes PEMT protein is within the Smith-Magenis syndrome region on chromosome 17.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PEMT antibody (70R-6491) | PEMT antibody (70R-6491) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors