PEO1 antibody (70R-4802)

Rabbit polyclonal PEO1 antibody raised against the middle region of Peo1

Synonyms Polyclonal PEO1 antibody, Anti-PEO1 antibody, C10orf2 antibody, PEO-1, SANDO antibody, TWINL antibody, PEOA3 antibody, PEO 1, PEO1, FLJ21832 antibody, PEO 1 antibody, PEO antibody, PEO-1 antibody
Specificity PEO1 antibody was raised against the middle region of Peo1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PEO1 antibody was raised using the middle region of Peo1 corresponding to a region with amino acids GVFRKFATDNNCHVTLVIHPRKEDDDKELQTASIFGSAKASQEADNVLIL
Assay Information PEO1 Blocking Peptide, catalog no. 33R-3637, is also available for use as a blocking control in assays to test for specificity of this PEO1 antibody

Images

Western Blot analysis using PEO1 antibody (70R-4802)

PEO1 antibody (70R-4802) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 77 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PEO1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Twinkle is a mitochondrial protein with structural similarity to the phage T7 primase/helicase (GP4) and other hexameric ring helicases. The twinkle protein colocalizes with mtDNA in mitochondrial nucleoids, and its name derives from the unusual localization pattern reminiscent of twinkling stars.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PEO1 antibody (70R-4802) | PEO1 antibody (70R-4802) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors