PERP antibody (70R-7291)

Rabbit polyclonal PERP antibody raised against the middle region of PERP

Synonyms Polyclonal PERP antibody, Anti-PERP antibody, PIGPC1 antibody, Perp Tp53Cell Cycle & Cell Death Effector antibody, KCP1 antibody, RP3-496H19.1 antibody, KRTCAP1 antibody, THW antibody, dJ496H19.1 antibody
Specificity PERP antibody was raised against the middle region of PERP
Cross Reactivity Human
Applications WB
Immunogen PERP antibody was raised using the middle region of PERP corresponding to a region with amino acids FLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFG
Assay Information PERP Blocking Peptide, catalog no. 33R-2984, is also available for use as a blocking control in assays to test for specificity of this PERP antibody

Images

Western Blot analysis using PERP antibody (70R-7291)

PERP antibody (70R-7291) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PERP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PERP is a component of intercellular desmosome junctions. PERP plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. PERP also plays a role as an effector in the TP53-dependent apoptotic pathway.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PERP antibody (70R-7291) | PERP antibody (70R-7291) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors