PEX10 antibody (70R-6974)

Rabbit polyclonal PEX10 antibody raised against the C terminal of PEX10

Synonyms Polyclonal PEX10 antibody, Anti-PEX10 antibody, MGC1998 antibody, NALD antibody, PEX10, PEX 10 antibody, PEX 10, RNF69 antibody, PEX-10 antibody, Peroxisome Biogenesis Factor 10 antibody, PEX-10
Specificity PEX10 antibody was raised against the C terminal of PEX10
Cross Reactivity Human
Applications WB
Immunogen PEX10 antibody was raised using the C terminal of PEX10 corresponding to a region with amino acids ERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQKLIYLRHYR
Assay Information PEX10 Blocking Peptide, catalog no. 33R-2712, is also available for use as a blocking control in assays to test for specificity of this PEX10 antibody


Western Blot analysis using PEX10 antibody (70R-6974)

PEX10 antibody (70R-6974) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PEX10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PEX10 is a protein involved in import of peroxisomal matrix proteins. This protein localizes to the peroxisomal membrane. Mutations in PEX10 gene result in phenotypes within the Zellweger spectrum of peroxisomal biogenesis disorders, ranging from neonatal adrenoleukodystrophy to Zellweger syndrome.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PEX10 antibody (70R-6974) | PEX10 antibody (70R-6974) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors