PEX11A antibody (70R-6611)

Rabbit polyclonal PEX11A antibody raised against the middle region of PEX11A

Synonyms Polyclonal PEX11A antibody, Anti-PEX11A antibody, PEXA-11, PEX11A, MGC138534 antibody, MGC119947 antibody, PEXA 11 antibody, PEX11-ALPHA antibody, PEXA 11, PEXA-11 antibody, Peroxisomal Biogenesis Factor 11A antibody
Specificity PEX11A antibody was raised against the middle region of PEX11A
Cross Reactivity Human
Applications WB
Immunogen PEX11A antibody was raised using the middle region of PEX11A corresponding to a region with amino acids MKRVTCDRAKKEKSASQDPLWFSVAEEETEWLQSFLLLLFRSLKQHPPLL
Assay Information PEX11A Blocking Peptide, catalog no. 33R-6165, is also available for use as a blocking control in assays to test for specificity of this PEX11A antibody

Images

Western Blot analysis using PEX11A antibody (70R-6611)

PEX11A antibody (70R-6611) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PEX11A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PEX11A belongs to the peroxin-11 family. It may be involved in peroxisomal proliferation and may regulate peroxisomes division. PEX11A may mediate binding of coatomer proteins to the peroxisomal membrane.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PEX11A antibody (70R-6611) | PEX11A antibody (70R-6611) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors