PEX7 antibody (70R-3689)

Rabbit polyclonal PEX7 antibody raised against the N terminal of PEX7

Synonyms Polyclonal PEX7 antibody, Anti-PEX7 antibody, RD antibody, PTS2R antibody, Peroxisomal Biogenesis Factor 7 antibody, PEX 7 antibody, PEX-7 antibody, RCDP1 antibody, PEX 7, PEX7, PEX-7
Specificity PEX7 antibody was raised against the N terminal of PEX7
Cross Reactivity Human,Mouse
Applications WB
Immunogen PEX7 antibody was raised using the N terminal of PEX7 corresponding to a region with amino acids MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI
Assay Information PEX7 Blocking Peptide, catalog no. 33R-6402, is also available for use as a blocking control in assays to test for specificity of this PEX7 antibody


Western Blot analysis using PEX7 antibody (70R-3689)

PEX7 antibody (70R-3689) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PEX7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PEX7 binds to the N-terminal PTS2-type peroxisomal targeting signal and plays an essential role in peroxisomal protein import.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PEX7 antibody (70R-3689) | PEX7 antibody (70R-3689) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors