PFDN6 antibody (70R-3349)

Rabbit polyclonal PFDN6 antibody raised against the N terminal of PFDN6

Synonyms Polyclonal PFDN6 antibody, Anti-PFDN6 antibody, PFDN-6 antibody, Prefoldin Subunit 6 antibody, PFDN 6, KE-2 antibody, MGC70744 antibody, PFDN6, PFDN-6, PFD6 antibody, HKE2 antibody, H2-KE2 antibody, PFDN 6 antibody
Specificity PFDN6 antibody was raised against the N terminal of PFDN6
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen PFDN6 antibody was raised using the N terminal of PFDN6 corresponding to a region with amino acids MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALL
Assay Information PFDN6 Blocking Peptide, catalog no. 33R-5640, is also available for use as a blocking control in assays to test for specificity of this PFDN6 antibody

Images

Western Blot analysis using PFDN6 antibody (70R-3349)

PFDN6 antibody (70R-3349) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 14 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PFDN6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PFDN6 binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. PFDN6 binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PFDN6 antibody (70R-3349) | PFDN6 antibody (70R-3349) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors