PFKFB4 antibody (70R-3800)

Rabbit polyclonal PFKFB4 antibody raised against the N terminal of PFKFB4

Synonyms Polyclonal PFKFB4 antibody, Anti-PFKFB4 antibody, PFKFB4, PFKFB 4 antibody, PFKFB-4 antibody, PFKFB 4, PFKFB-4, 6-Phosphofructo-2-Kinase/Fructose-26-Biphosphatase 4 antibody
Specificity PFKFB4 antibody was raised against the N terminal of PFKFB4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PFKFB4 antibody was raised using the N terminal of PFKFB4 corresponding to a region with amino acids MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPAR
Assay Information PFKFB4 Blocking Peptide, catalog no. 33R-5758, is also available for use as a blocking control in assays to test for specificity of this PFKFB4 antibody

Images

Western Blot analysis using PFKFB4 antibody (70R-3800)

PFKFB4 antibody (70R-3800) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PFKFB4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PFKFB4 synthesis and degradation of fructose 2,6-bisphosphate.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PFKFB4 antibody (70R-3800) | PFKFB4 antibody (70R-3800) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors