PGAM2 antibody (70R-4102)

Rabbit polyclonal PGAM2 antibody

Synonyms Polyclonal PGAM2 antibody, Anti-PGAM2 antibody, PGAMM antibody, PGAM 2, PGAM2, PGAM 2 antibody, MGC88743 antibody, PGAM-2 antibody, Phosphoglycerate Mutase 2 antibody, PGAM-2
Cross Reactivity Human
Applications WB
Immunogen PGAM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDAKM
Assay Information PGAM2 Blocking Peptide, catalog no. 33R-5774, is also available for use as a blocking control in assays to test for specificity of this PGAM2 antibody

Images

Western Blot analysis using PGAM2 antibody (70R-4102)

PGAM2 antibody (70R-4102) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PGAM2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PGAM2 is the interconversion of 3- and 2-phosphoglycerate with 2,3-bisphosphoglycerate as the primer of the reaction. It can also catalyze the reaction of EC 5.4.2.4 (synthase) and EC 3.1.3.13 (phosphatase), but with a reduced activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PGAM2 antibody (70R-4102) | PGAM2 antibody (70R-4102) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors