PGBD2 antibody (70R-4210)

Rabbit polyclonal PGBD2 antibody raised against the middle region of PGBD2

Synonyms Polyclonal PGBD2 antibody, Anti-PGBD2 antibody, PGBD2, PGBD-2 antibody, Piggybac Transposable Element Derived 2 antibody, PGBD 2, PGBD 2 antibody, PGBD-2
Specificity PGBD2 antibody was raised against the middle region of PGBD2
Cross Reactivity Human
Applications WB
Immunogen PGBD2 antibody was raised using the middle region of PGBD2 corresponding to a region with amino acids RICCQDAQVDLLAFRRYIACVYLESNADTTSQGRRSRRLETESRFDMIGH
Assay Information PGBD2 Blocking Peptide, catalog no. 33R-7960, is also available for use as a blocking control in assays to test for specificity of this PGBD2 antibody

Images

Western Blot analysis using PGBD2 antibody (70R-4210)

PGBD2 antibody (70R-4210) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PGBD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. The exact function of this gene is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PGBD2 antibody (70R-4210) | PGBD2 antibody (70R-4210) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors