PGCP antibody (70R-5467)

Rabbit polyclonal PGCP antibody raised against the N terminal of PGCP

Synonyms Polyclonal PGCP antibody, Anti-PGCP antibody, Plasma Glutamate Carboxypeptidase antibody
Specificity PGCP antibody was raised against the N terminal of PGCP
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PGCP antibody was raised using the N terminal of PGCP corresponding to a region with amino acids VDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESA
Assay Information PGCP Blocking Peptide, catalog no. 33R-9484, is also available for use as a blocking control in assays to test for specificity of this PGCP antibody

Images

Western Blot analysis using PGCP antibody (70R-5467)

PGCP antibody (70R-5467) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PGCP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PGCP is a carboxypeptidase that may play an important role in the hydrolysis of circulating peptides.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PGCP antibody (70R-5467) | PGCP antibody (70R-5467) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors