PGK1 antibody (70R-1199)

Rabbit polyclonal PGK1 antibody raised against the C terminal of PGK1

Synonyms Polyclonal PGK1 antibody, Anti-PGK1 antibody, PGK 1 antibody, PGK 1, MIG10 antibody, MGC117307 antibody, PGKA antibody, MGC8947 antibody, PGK-1 antibody, PGK1, Phosphoglycerate Kinase 1 antibody, PGK-1, MGC142128 antibody
Specificity PGK1 antibody was raised against the C terminal of PGK1
Cross Reactivity Human
Applications IHC, WB
Immunogen PGK1 antibody was raised using the C terminal of PGK1 corresponding to a region with amino acids ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR
Assay Information PGK1 Blocking Peptide, catalog no. 33R-1574, is also available for use as a blocking control in assays to test for specificity of this PGK1 antibody


Immunohistochemical staining using PGK1 antibody (70R-1199)

PGK1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PGK1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PGK1 is a glycolytic enzyme that catalyzes the conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate. The protein may also act as a cofactor for polymerase alpha.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using PGK1 antibody (70R-1199) | PGK1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X
  • Western Blot analysis using PGK1 antibody (70R-1199) | PGK1 antibody (70R-1199) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors