PGM3 antibody (70R-3268)

Rabbit polyclonal PGM3 antibody raised against the middle region of PGM3

Synonyms Polyclonal PGM3 antibody, Anti-PGM3 antibody, PGM-3 antibody, PGM3, PGM-3, PGM 3 antibody, DKFZp434B187 antibody, PAGM antibody, Phosphoglucomutase 3 antibody, PGM 3, AGM1 antibody
Specificity PGM3 antibody was raised against the middle region of PGM3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PGM3 antibody was raised using the middle region of PGM3 corresponding to a region with amino acids GVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEAN
Assay Information PGM3 Blocking Peptide, catalog no. 33R-3660, is also available for use as a blocking control in assays to test for specificity of this PGM3 antibody


Western Blot analysis using PGM3 antibody (70R-3268)

PGM3 antibody (70R-3268) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PGM3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PGM3 interconverts GlcNAc-6-P and GlcNAc-1-P.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PGM3 antibody (70R-3268) | PGM3 antibody (70R-3268) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors