PGRMC1 antibody (70R-6737)

Rabbit polyclonal PGRMC1 antibody raised against the N terminal of PGRMC1

Synonyms Polyclonal PGRMC1 antibody, Anti-PGRMC1 antibody, Progesterone Receptor Membrane Component 1 antibody, MPR antibody, PGRMC-1 antibody, PGRMC 1, PGRMC-1, HPR6.6 antibody, PGRMC 1 antibody, PGRMC1
Specificity PGRMC1 antibody was raised against the N terminal of PGRMC1
Cross Reactivity Human
Applications IHC, WB
Immunogen PGRMC1 antibody was raised using the N terminal of PGRMC1 corresponding to a region with amino acids MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ
Assay Information PGRMC1 Blocking Peptide, catalog no. 33R-5590, is also available for use as a blocking control in assays to test for specificity of this PGRMC1 antibody

Images

Immunohistochemical staining using PGRMC1 antibody (70R-6737)

PGRMC1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain EpitheliaI cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PGRMC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Progesterone binding protein is a putative steroid membrane receptor. The protein is expressed predominantly in the liver and kidney.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using PGRMC1 antibody (70R-6737) | PGRMC1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain EpitheliaI cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X
  • Western Blot analysis using PGRMC1 antibody (70R-6737) | PGRMC1 antibody (70R-6737) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors