PGS1 antibody (70R-5274)

Rabbit polyclonal PGS1 antibody raised against the C terminal of PGS1

Synonyms Polyclonal PGS1 antibody, Anti-PGS1 antibody, PGS-1, PGS-1 antibody, DKFZP762M186 antibody, Phosphatidylglycerophosphate Synthase 1 antibody, MGC131960 antibody, PGS1, PGS 1, PGS 1 antibody
Specificity PGS1 antibody was raised against the C terminal of PGS1
Cross Reactivity Human
Applications IHC, WB
Immunogen PGS1 antibody was raised using the C terminal of PGS1 corresponding to a region with amino acids QIAIVTENQALQQQLHQEQEQLYLRSGVVSSATFEQPSRQVKLWVKMVTP
Assay Information PGS1 Blocking Peptide, catalog no. 33R-7584, is also available for use as a blocking control in assays to test for specificity of this PGS1 antibody


Immunohistochemical staining using PGS1 antibody (70R-5274)

PGS1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Neural cells (arrows) in Human Brain. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PGS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PGS1 functions in the biosynthesis of the anionic phospholipids phosphatidylglycerol and cardiolipin.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using PGS1 antibody (70R-5274) | PGS1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Neural cells (arrows) in Human Brain. Magnification is at 400X
  • Western Blot analysis using PGS1 antibody (70R-5274) | PGS1 antibody (70R-5274) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors